Recombinant Human CALR protein, GST-tagged
Cat.No. : | CALR-2625H |
Product Overview : | Recombinant Human CALR protein(P27797)(18-417aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 18-417aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 73.5 kDa |
AA Sequence : | EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CALR calreticulin [ Homo sapiens ] |
Official Symbol | CALR |
Synonyms | CALR; calreticulin; autoantigen Ro; cC1qR; CRT; FLJ26680; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin); |
Gene ID | 811 |
mRNA Refseq | NM_004343 |
Protein Refseq | NP_004334 |
MIM | 109091 |
UniProt ID | P27797 |
◆ Recombinant Proteins | ||
CALR-104C | Recombinant Cynomolgus Monkey CALR Protein, His (Fc)-Avi-tagged | +Inquiry |
CALR-1097R | Recombinant Rat CALR Protein | +Inquiry |
CALR-610R | Recombinant Rhesus monkey CALR Protein, His-tagged | +Inquiry |
CALR-1433C | Recombinant Chinese hamster CALR protein, His-tagged | +Inquiry |
CALR-0821H | Recombinant Human CALR Protein (Glu18-Pro204), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
0
Inquiry Basket