Recombinant Human CAMK2A protein, GST-tagged
Cat.No. : | CAMK2A-3396H |
Product Overview : | Recombinant Human SORL1 protein(1865-2137 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1865-2137 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVA |
Gene Name | SORL1 sortilin-related receptor, L(DLR class) A repeats containing [ Homo sapiens ] |
Official Symbol | SORL1 |
Synonyms | SORL1; sortilin-related receptor, L(DLR class) A repeats containing; C11orf32, chromosome 11 open reading frame 32 , sortilin related receptor, L(DLR class) A repeats containing; sortilin-related receptor; gp250; LR11; LRP9; SorLA; SorLA 1; mosaic protein LR11; LDLR relative with 11 ligand-binding repeats; sortilin-related receptor, L(DLR class) A repeats-containing; sorting protein-related receptor containing LDLR class A repeats; low-density lipoprotein receptor relative with 11 ligand-binding repeats; SORLA; SorLA-1; C11orf32; FLJ21930; FLJ39258; |
Gene ID | 6653 |
mRNA Refseq | NM_003105 |
Protein Refseq | NP_003096 |
MIM | 602005 |
UniProt ID | Q92673 |
◆ Recombinant Proteins | ||
CAMK2A-3394H | Recombinant Human CAMK2A protein, His-tagged | +Inquiry |
CAMK2A-0326H | Recombinant Human CAMK2A Protein, GST-Tagged | +Inquiry |
CAMK2A-32HFL | Active Recombinant Full Length Human CAMK2A Protein, N-His-tagged | +Inquiry |
CAMK2A-777H | Active Recombinant Human CAMK2A protein, GST-tagged | +Inquiry |
Camk2a-746R | Active Recombinant Rat Camk2a | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2A-7881HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
CAMK2A-7880HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMK2A Products
Required fields are marked with *
My Review for All CAMK2A Products
Required fields are marked with *