Recombinant Human CAMK2A protein, GST-tagged
| Cat.No. : | CAMK2A-3396H |
| Product Overview : | Recombinant Human SORL1 protein(1865-2137 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1865-2137 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVA |
| Gene Name | SORL1 sortilin-related receptor, L(DLR class) A repeats containing [ Homo sapiens ] |
| Official Symbol | SORL1 |
| Synonyms | SORL1; sortilin-related receptor, L(DLR class) A repeats containing; C11orf32, chromosome 11 open reading frame 32 , sortilin related receptor, L(DLR class) A repeats containing; sortilin-related receptor; gp250; LR11; LRP9; SorLA; SorLA 1; mosaic protein LR11; LDLR relative with 11 ligand-binding repeats; sortilin-related receptor, L(DLR class) A repeats-containing; sorting protein-related receptor containing LDLR class A repeats; low-density lipoprotein receptor relative with 11 ligand-binding repeats; SORLA; SorLA-1; C11orf32; FLJ21930; FLJ39258; |
| Gene ID | 6653 |
| mRNA Refseq | NM_003105 |
| Protein Refseq | NP_003096 |
| MIM | 602005 |
| UniProt ID | Q92673 |
| ◆ Recombinant Proteins | ||
| CAMK2A-765R | Recombinant Rat CAMK2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAMK2A-0178H | Recombinant Human CAMK2A Protein (A2-H478), GST tagged | +Inquiry |
| CAMK2A-0326H | Recombinant Human CAMK2A Protein, GST-Tagged | +Inquiry |
| CAMK2A-6286H | Recombinant Human CAMK2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CAMK2A-0177H | Recombinant Human CAMK2A Protein (A2-H478), Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAMK2A-7881HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
| CAMK2A-7880HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMK2A Products
Required fields are marked with *
My Review for All CAMK2A Products
Required fields are marked with *



