Recombinant Human CAPN1 Protein, GST-Tagged

Cat.No. : CAPN1-0355H
Product Overview : Human CAPN1 partial ORF (AAH08751, 610 a.a. - 714 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Molecular Mass : 37.18 kDa
AA Sequence : FNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CAPN1 calpain 1, (mu/I) large subunit [ Homo sapiens ]
Official Symbol CAPN1
Synonyms CAPN1; calpain 1, (mu/I) large subunit; calpain-1 catalytic subunit; CANP; CANPL1; muCANP; muCL; CANP 1; calpain mu-type; micromolar-calpain; calpain-1 large subunit; calpain, large polypeptide L1; calcium-activated neutral proteinase 1; cell proliferation-inducing protein 30; cell proliferation-inducing gene 30 protein; CANP1;
Gene ID 823
mRNA Refseq NM_001198868
Protein Refseq NP_001185797
MIM 114220
UniProt ID P07384

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAPN1 Products

Required fields are marked with *

My Review for All CAPN1 Products

Required fields are marked with *

0
cart-icon