Recombinant Human CAPN1 Protein, GST-Tagged
Cat.No. : | CAPN1-0355H |
Product Overview : | Human CAPN1 partial ORF (AAH08751, 610 a.a. - 714 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 37.18 kDa |
AA Sequence : | FNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAPN1 calpain 1, (mu/I) large subunit [ Homo sapiens ] |
Official Symbol | CAPN1 |
Synonyms | CAPN1; calpain 1, (mu/I) large subunit; calpain-1 catalytic subunit; CANP; CANPL1; muCANP; muCL; CANP 1; calpain mu-type; micromolar-calpain; calpain-1 large subunit; calpain, large polypeptide L1; calcium-activated neutral proteinase 1; cell proliferation-inducing protein 30; cell proliferation-inducing gene 30 protein; CANP1; |
Gene ID | 823 |
mRNA Refseq | NM_001198868 |
Protein Refseq | NP_001185797 |
MIM | 114220 |
UniProt ID | P07384 |
◆ Recombinant Proteins | ||
CAPN1-2690M | Recombinant Mouse CAPN1 Protein | +Inquiry |
CAPN1-164H | Recombinant Human CAPN1 | +Inquiry |
CAPN1-27399TH | Recombinant Human CAPN1, His-tagged | +Inquiry |
CAPN1-2587H | Recombinant Human CAPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPN1-1213M | Recombinant Mouse CAPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN1-7865HCL | Recombinant Human CAPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPN1 Products
Required fields are marked with *
My Review for All CAPN1 Products
Required fields are marked with *
0
Inquiry Basket