Recombinant Human CAPNS2 Protein, GST-Tagged
| Cat.No. : | CAPNS2-0375H |
| Product Overview : | Human CAPNS2 full-length ORF (AAH05397, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CAPNS2 (Calpain Small Subunit 2) is a Protein Coding gene. Among its related pathways are Degradation of the extracellular matrix and Neurodegenerative Diseases. GO annotations related to this gene include calcium ion binding and calcium-dependent cysteine-type endopeptidase activity. An important paralog of this gene is CAPNS1. |
| Molecular Mass : | 53.02 kDa |
| AA Sequence : | MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CAPNS2 calpain, small subunit 2 [ Homo sapiens ] |
| Official Symbol | CAPNS2 |
| Synonyms | CAPNS2; calpain, small subunit 2; calpain small subunit 2; MGC12536; MGC14804; CSS2; calcium-dependent protease small subunit 2; |
| Gene ID | 84290 |
| mRNA Refseq | NM_032330 |
| Protein Refseq | NP_115706 |
| UniProt ID | Q96L46 |
| ◆ Recombinant Proteins | ||
| CAPNS2-2702M | Recombinant Mouse CAPNS2 Protein | +Inquiry |
| CAPNS2-2831HF | Recombinant Full Length Human CAPNS2 Protein, GST-tagged | +Inquiry |
| Capns2-1954M | Recombinant Mouse Capns2 Protein, Myc/DDK-tagged | +Inquiry |
| CAPNS2-10708H | Recombinant Human CAPNS2, GST-tagged | +Inquiry |
| CAPNS2-6041H | Recombinant Human CAPNS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAPNS2-7858HCL | Recombinant Human CAPNS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPNS2 Products
Required fields are marked with *
My Review for All CAPNS2 Products
Required fields are marked with *
