Recombinant Human CAPNS2 Protein, GST-Tagged

• Cat.No.: CAPNS2-0375H
• Product Overview: Human CAPNS2 full-length ORF (AAH05397, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CAPNS2 (Calpain Small Subunit 2) is a Protein Coding gene. Among its related pathways are Degradation of the extracellular matrix and Neurodegenerative Diseases. GO annotations related to this gene include calcium ion binding and calcium-dependent cysteine-type endopeptidase activity. An important paralog of this gene is CAPNS1.
• Molecular Mass: 53.02 kDa
• AA Sequence: MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CAPNS2 calpain, small subunit 2 [ Homo sapiens ]
• Official Symbol: CAPNS2
• Synonyms: CAPNS2; calpain, small subunit 2; calpain small subunit 2; MGC12536; MGC14804; CSS2; calcium-dependent protease small subunit 2
• Gene ID: 84290
• mRNA Refseq: NM_032330
• Protein Refseq: NP_115706
• UniProt ID: Q96L46