Recombinant Human CARM1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CARM1-4776H |
Product Overview : | CARM1 MS Standard C13 and N15-labeled recombinant protein (NP_954592) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9. |
Molecular Mass : | 65.7 kDa |
AA Sequence : | MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVXLWLWDPVVFCRPSWSTENLRGXRPAPWPSTXEVLVKSNNLTDRIVVIPGKVXGXCXXPXXQVDIIXLGAHGLHALQRXACWRATSTPXKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CARM1 coactivator-associated arginine methyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | CARM1 |
Synonyms | CARM1; coactivator-associated arginine methyltransferase 1; histone-arginine methyltransferase CARM1; PRMT4; protein arginine N-methyltransferase 4; |
Gene ID | 10498 |
mRNA Refseq | NM_199141 |
Protein Refseq | NP_954592 |
MIM | 603934 |
UniProt ID | Q86X55 |
◆ Recombinant Proteins | ||
CARM1-503H | Recombinant Human CARM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CARM1-0402H | Recombinant Human CARM1 Protein, GST-Tagged | +Inquiry |
CARM1-617H | Recombinant Human CARM1, His-tagged | +Inquiry |
CARM1-1139R | Recombinant Rat CARM1 Protein | +Inquiry |
CARM1-1232M | Recombinant Mouse CARM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARM1-7846HCL | Recombinant Human CARM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CARM1 Products
Required fields are marked with *
My Review for All CARM1 Products
Required fields are marked with *
0
Inquiry Basket