Recombinant Human CARTPT Protein, GST-Tagged
Cat.No. : | CARTPT-0406H |
Product Overview : | Human CART full-length ORF (AAH29882, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CARTPT CART prepropeptide [ Homo sapiens ] |
Official Symbol | CARTPT |
Synonyms | CARTPT; CART prepropeptide; cocaine- and amphetamine-regulated transcript protein; CART; cocaine and amphetamine regulated transcript; |
Gene ID | 9607 |
mRNA Refseq | NM_004291 |
Protein Refseq | NP_004282 |
MIM | 602606 |
UniProt ID | Q16568 |
◆ Recombinant Proteins | ||
CARTPT-1726H | Recombinant Human CARTPT protein, His-tagged | +Inquiry |
CARTPT-3822B | Recombinant Bovine CARTPT Protein (Met1-Leu116), C-Fc tagged | +Inquiry |
CARTPT-2518H | Recombinant Human CARTPT Protein, MYC/DDK-tagged | +Inquiry |
CARTPT-1980H | Recombinant Human CARTPT protein, mFc-tagged | +Inquiry |
CARTPT-10725H | Recombinant Human CARTPT protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARTPT-911HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
CARTPT-001HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CARTPT Products
Required fields are marked with *
My Review for All CARTPT Products
Required fields are marked with *
0
Inquiry Basket