Recombinant Human CARTPT Protein, GST-Tagged
| Cat.No. : | CARTPT-0406H | 
| Product Overview : | Human CART full-length ORF (AAH29882, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans. [provided by RefSeq, Feb 2016] | 
| Molecular Mass : | 38.5 kDa | 
| AA Sequence : | MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CARTPT CART prepropeptide [ Homo sapiens ] | 
| Official Symbol | CARTPT | 
| Synonyms | CARTPT; CART prepropeptide; cocaine- and amphetamine-regulated transcript protein; CART; cocaine and amphetamine regulated transcript; | 
| Gene ID | 9607 | 
| mRNA Refseq | NM_004291 | 
| Protein Refseq | NP_004282 | 
| MIM | 602606 | 
| UniProt ID | Q16568 | 
| ◆ Recombinant Proteins | ||
| CARTPT-2899HF | Recombinant Full Length Human CARTPT Protein, GST-tagged | +Inquiry | 
| CARTPT-233H | Recombinant Human CARTPT, Fc tagged | +Inquiry | 
| CARTPT-2518H | Recombinant Human CARTPT Protein, MYC/DDK-tagged | +Inquiry | 
| CARTPT-53H | Recombinant Human CARTPT, His-tagged | +Inquiry | 
| CARTPT-240H | Recombinant Human CARTPT | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CARTPT-911HCL | Recombinant Human CARTPT cell lysate | +Inquiry | 
| CARTPT-001HCL | Recombinant Human CARTPT cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARTPT Products
Required fields are marked with *
My Review for All CARTPT Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            