Recombinant Human CASP1 protein, GST-tagged
Cat.No. : | CASP1-2634H |
Product Overview : | Recombinant Human CASP1 protein(P29466)(120-269aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 120-269aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.8 kDa |
AA Sequence : | NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CASP1 caspase 1, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP1 |
Synonyms | CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase 1, apoptosis related cysteine peptidase (interleukin 1, beta, convertase) , caspase 1, apoptosis related cysteine protease (interleukin 1, beta, convertase) , IL1BC; caspase-1; caspase 1; ICE; interleukin 1; beta; convertase; IL1B-convertase; CASP1 nirs variant 1; IL-1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); P45; IL1BC; |
Gene ID | 834 |
mRNA Refseq | NM_001223 |
Protein Refseq | NP_001214 |
MIM | 147678 |
UniProt ID | P29466 |
◆ Recombinant Proteins | ||
CASP1-2634H | Recombinant Human CASP1 protein, GST-tagged | +Inquiry |
CASP1-0411H | Recombinant Human CASP1 Protein, GST-Tagged | +Inquiry |
CASP1-1265H | Recombinant Human CASP1 Protein (N120-D297, A317-H404), Tag Free | +Inquiry |
Casp1-577R | Recombinant Rat Casp1 protein, His-tagged | +Inquiry |
RFL8659AF | Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 1(Casp1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *
0
Inquiry Basket