Recombinant Human CASP1 protein, GST-tagged
| Cat.No. : | CASP1-2634H |
| Product Overview : | Recombinant Human CASP1 protein(P29466)(120-269aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 120-269aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.8 kDa |
| AA Sequence : | NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CASP1 caspase 1, apoptosis-related cysteine peptidase [ Homo sapiens ] |
| Official Symbol | CASP1 |
| Synonyms | CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase 1, apoptosis related cysteine peptidase (interleukin 1, beta, convertase) , caspase 1, apoptosis related cysteine protease (interleukin 1, beta, convertase) , IL1BC; caspase-1; caspase 1; ICE; interleukin 1; beta; convertase; IL1B-convertase; CASP1 nirs variant 1; IL-1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); P45; IL1BC; |
| Gene ID | 834 |
| mRNA Refseq | NM_001223 |
| Protein Refseq | NP_001214 |
| MIM | 147678 |
| UniProt ID | P29466 |
| ◆ Recombinant Proteins | ||
| CASP1-2634H | Recombinant Human CASP1 protein, GST-tagged | +Inquiry |
| CASP1-10729H | Recombinant Human CASP1, GST-tagged | +Inquiry |
| CASP1-0411H | Recombinant Human CASP1 Protein, GST-Tagged | +Inquiry |
| Casp1-0413M | Active Recombinant Mouse Casp1 Protein | +Inquiry |
| CASP1-1266H | Recombinant Human CASP1 Protein (N120-D297, A317-H404), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
| CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *



