"CASP5" Related Products

Expand
Expand

Recombinant Human CASP5 Protein, GST-Tagged

Cat.No. : CASP5-0425H
Product Overview : Human CASP5 partial ORF (NP_004338, 309 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Aug 2010]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 37.84 kDa
AA Sequence : VRDSPASLAVISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CASP5 caspase 5, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol : CASP5
Synonyms : CASP5; caspase 5, apoptosis-related cysteine peptidase; caspase 5, apoptosis related cysteine protease; caspase-5; ICE(rel)III; CASP-5; TY protease; protease TY; ICE(rel)-III; protease ICH-3; caspase 5, apoptosis-related cysteine protease; ICH-3; ICEREL-III; MGC141966;
Gene ID : 838
mRNA Refseq : NM_001136109
Protein Refseq : NP_001129581
MIM : 602665
UniProt ID : P51878

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.