Recombinant Human CASP5 Protein, GST-Tagged
Cat.No. : | CASP5-0425H |
Product Overview : | Human CASP5 partial ORF (NP_004338, 309 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Aug 2010] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | VRDSPASLAVISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASP5 caspase 5, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP5 |
Synonyms | CASP5; caspase 5, apoptosis-related cysteine peptidase; caspase 5, apoptosis related cysteine protease; caspase-5; ICE(rel)III; CASP-5; TY protease; protease TY; ICE(rel)-III; protease ICH-3; caspase 5, apoptosis-related cysteine protease; ICH-3; ICEREL-III; MGC141966; |
Gene ID | 838 |
mRNA Refseq | NM_001136109 |
Protein Refseq | NP_001129581 |
MIM | 602665 |
UniProt ID | P51878 |
◆ Recombinant Proteins | ||
CASP5-32H | Active Recombinant Human Caspase-5 Enzyme | +Inquiry |
CASP5-608H | Recombinant Human CASP5 | +Inquiry |
CASP5-0425H | Recombinant Human CASP5 Protein, GST-Tagged | +Inquiry |
CASP5-600H | Recombinant Human Caspase 5, Apoptosis-related Cysteine Peptidase | +Inquiry |
CASP5-821H | Recombinant Human CASP5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP5-7835HCL | Recombinant Human CASP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASP5 Products
Required fields are marked with *
My Review for All CASP5 Products
Required fields are marked with *
0
Inquiry Basket