Recombinant Human CASP5 Protein, GST-Tagged

Cat.No. : CASP5-0425H
Product Overview : Human CASP5 partial ORF (NP_004338, 309 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Aug 2010]
Molecular Mass : 37.84 kDa
AA Sequence : VRDSPASLAVISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CASP5 caspase 5, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP5
Synonyms CASP5; caspase 5, apoptosis-related cysteine peptidase; caspase 5, apoptosis related cysteine protease; caspase-5; ICE(rel)III; CASP-5; TY protease; protease TY; ICE(rel)-III; protease ICH-3; caspase 5, apoptosis-related cysteine protease; ICH-3; ICEREL-III; MGC141966;
Gene ID 838
mRNA Refseq NM_001136109
Protein Refseq NP_001129581
MIM 602665
UniProt ID P51878

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASP5 Products

Required fields are marked with *

My Review for All CASP5 Products

Required fields are marked with *

0
cart-icon