Recombinant Human CASP9 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CASP9-3270H
Product Overview : CASP9 MS Standard C13 and N15-labeled recombinant protein (NP_127463) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein can undergo autoproteolytic processing and activation by the apoptosome, a protein complex of cytochrome c and the apoptotic peptidase activating factor 1; this step is thought to be one of the earliest in the caspase activation cascade. This protein is thought to play a central role in apoptosis and to be a tumor suppressor. Alternative splicing results in multiple transcript variants.
Molecular Mass : 30 kDa
AA Sequence : MDEADRRLLRRCRLRLVEELQVDQLWDVLLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CASP9 caspase 9 [ Homo sapiens (human) ]
Official Symbol CASP9
Synonyms CASP9; caspase 9, apoptosis-related cysteine peptidase; caspase 9, apoptosis related cysteine protease; caspase-9; APAF 3; ICE LAP6; MCH6; PPP1R56; protein phosphatase 1; regulatory subunit 56; apoptotic protease MCH-6; ICE-like apoptotic protease 6; apoptotic protease activating factor 3; protein phosphatase 1, regulatory subunit 56; APAF3; APAF-3; ICE-LAP6; CASPASE-9c;
Gene ID 842
mRNA Refseq NM_032996
Protein Refseq NP_127463
MIM 602234
UniProt ID P55211

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASP9 Products

Required fields are marked with *

My Review for All CASP9 Products

Required fields are marked with *

0
cart-icon
0
compare icon