Recombinant Human CASP9 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CASP9-3270H |
| Product Overview : | CASP9 MS Standard C13 and N15-labeled recombinant protein (NP_127463) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein can undergo autoproteolytic processing and activation by the apoptosome, a protein complex of cytochrome c and the apoptotic peptidase activating factor 1; this step is thought to be one of the earliest in the caspase activation cascade. This protein is thought to play a central role in apoptosis and to be a tumor suppressor. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 30 kDa |
| AA Sequence : | MDEADRRLLRRCRLRLVEELQVDQLWDVLLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CASP9 caspase 9 [ Homo sapiens (human) ] |
| Official Symbol | CASP9 |
| Synonyms | CASP9; caspase 9, apoptosis-related cysteine peptidase; caspase 9, apoptosis related cysteine protease; caspase-9; APAF 3; ICE LAP6; MCH6; PPP1R56; protein phosphatase 1; regulatory subunit 56; apoptotic protease MCH-6; ICE-like apoptotic protease 6; apoptotic protease activating factor 3; protein phosphatase 1, regulatory subunit 56; APAF3; APAF-3; ICE-LAP6; CASPASE-9c; |
| Gene ID | 842 |
| mRNA Refseq | NM_032996 |
| Protein Refseq | NP_127463 |
| MIM | 602234 |
| UniProt ID | P55211 |
| ◆ Recombinant Proteins | ||
| Casp9-629R | Recombinant Rat Casp9 protein, His-tagged | +Inquiry |
| Casp9-628M | Recombinant Mouse Casp9 protein, His-tagged | +Inquiry |
| CASP9-48H | Recombinant Human CASP9 protein, MYC/DDK-tagged | +Inquiry |
| CASP9-627H | Recombinant Human CASP9 protein, His-tagged | +Inquiry |
| CASP9-148H | Recombinant Human CASP9 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASP9-7828HCL | Recombinant Human CASP9 293 Cell Lysate | +Inquiry |
| CASP9-087HKCL | Human CASP9 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP9 Products
Required fields are marked with *
My Review for All CASP9 Products
Required fields are marked with *
