Recombinant Human CASQ2 protein, GST-tagged
Cat.No. : | CASQ2-301241H |
Product Overview : | Recombinant Human CASQ2 (273-399 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Phe273-Glu399 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | FAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CASQ2 calsequestrin 2 (cardiac muscle) [ Homo sapiens ] |
Official Symbol | CASQ2 |
Synonyms | CASQ2; calsequestrin 2 (cardiac muscle); calsequestrin-2; PDIB2; calsequestrin, cardiac muscle isoform; calsequestrin 2, fast-twitch, cardiac muscle; FLJ26321; FLJ93514; |
Gene ID | 845 |
mRNA Refseq | NM_001232 |
Protein Refseq | NP_001223 |
MIM | 114251 |
UniProt ID | O14958 |
◆ Recombinant Proteins | ||
CASQ2-4248H | Recombinant Human Calsequestrin 2 (Cardiac Muscle), His-tagged | +Inquiry |
Casq2-775M | Recombinant Mouse Casq2 Protein, MYC/DDK-tagged | +Inquiry |
Casq2-1745M | Recombinant Mouse Casq2 protein, His & T7-tagged | +Inquiry |
CASQ2-2750HF | Recombinant Full Length Human CASQ2 Protein, GST-tagged | +Inquiry |
CASQ2-1250M | Recombinant Mouse CASQ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASQ2-7826HCL | Recombinant Human CASQ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASQ2 Products
Required fields are marked with *
My Review for All CASQ2 Products
Required fields are marked with *