Recombinant Human CASQ2 protein, GST-tagged
| Cat.No. : | CASQ2-301241H |
| Product Overview : | Recombinant Human CASQ2 (273-399 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Phe273-Glu399 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | FAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CASQ2 calsequestrin 2 (cardiac muscle) [ Homo sapiens ] |
| Official Symbol | CASQ2 |
| Synonyms | CASQ2; calsequestrin 2 (cardiac muscle); calsequestrin-2; PDIB2; calsequestrin, cardiac muscle isoform; calsequestrin 2, fast-twitch, cardiac muscle; FLJ26321; FLJ93514; |
| Gene ID | 845 |
| mRNA Refseq | NM_001232 |
| Protein Refseq | NP_001223 |
| MIM | 114251 |
| UniProt ID | O14958 |
| ◆ Recombinant Proteins | ||
| CASQ2-789Z | Recombinant Zebrafish CASQ2 | +Inquiry |
| CASQ2-032H | Recombinant Human calsequestrin 2 Protein, His tagged | +Inquiry |
| Casq2-1745M | Recombinant Mouse Casq2 protein, His & T7-tagged | +Inquiry |
| CASQ2-301241H | Recombinant Human CASQ2 protein, GST-tagged | +Inquiry |
| CASQ2-6095C | Recombinant Chicken CASQ2 | +Inquiry |
| ◆ Native Proteins | ||
| CASQ2-30C | Native Canine CASQ2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASQ2-7826HCL | Recombinant Human CASQ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASQ2 Products
Required fields are marked with *
My Review for All CASQ2 Products
Required fields are marked with *



