Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CASR

Cat.No. : CASR-27796TH
Product Overview : Recombinant fragment corresponding to amino acids 21-130 of Human Calcium Sensing Receptor with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a G protein-coupled receptor that is expressed in the parathyroid hormone (PTH)-producing chief cells of the parathyroid gland, and the cells lining the kidney tubule. It senses small changes in circulating calcium concentration and couples this information to intracellular signaling pathways that modify PTH secretion or renal cation handling, thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene cause familial hypocalciuric hypercalcemia, familial, isolated hypoparathyroidism, and neonatal severe primary hyperparathyroidism.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in the temporal lobe, frontal lobe, parietal lobe, hippocampus, and cerebellum. Also found in kidney, lung, liver, heart, skeletal muscle, placenta.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC IRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDT CNTVSKALEATLSFVAQNKIDSLNLDEFCN
Sequence Similarities : Belongs to the G-protein coupled receptor 3 family.
Gene Name : CASR calcium-sensing receptor [ Homo sapiens ]
Official Symbol : CASR
Synonyms : CASR; calcium-sensing receptor; HHC, HHC1, hypocalciuric hypercalcemia 1; extracellular calcium-sensing receptor; FHH; GPRC2A; NSHPT; severe neonatal hyperparathyroidism;
Gene ID : 846
mRNA Refseq : NM_000388
Protein Refseq : NP_000379
Uniprot ID : P41180
Chromosome Location : 3q21.1
Pathway : Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; E-cadherin signaling in keratinocytes, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function : G-protein coupled receptor activity; phosphatidylinositol phospholipase C activity; protein binding; receptor activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends