Recombinant Human CASR Protein (20-612 aa), GST-tagged
Cat.No. : | CASR-385H |
Product Overview : | Recombinant Human CASR Protein (20-612 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 20-612 aa |
Description : | Senses changes in the Extracellular domain concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger syst. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 93.6 kDa |
AA Sequence : | YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CASR calcium-sensing receptor [ Homo sapiens ] |
Official Symbol | CASR |
Synonyms | CASR; FHH; GPRC2A; NSHPT; CAR; FIH; HHC; EIG8; HHC1; PCAR1; MGC138441; |
Gene ID | 846 |
mRNA Refseq | NM_000388 |
Protein Refseq | NP_000379 |
UniProt ID | P41180 |
◆ Recombinant Proteins | ||
CASR-0439H | Recombinant Human CASR Protein, GST-Tagged | +Inquiry |
CASR-1148R | Recombinant Rat CASR Protein | +Inquiry |
CASR-2757H | Recombinant Human CASR protein(871-1070 aa), C-His-tagged | +Inquiry |
CASR-0502H | Recombinant Human CASR Protein (Y20-S1078 end), Flag, 10×His tagged | +Inquiry |
Casr-651M | Recombinant Mouse Casr Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASR-7825HCL | Recombinant Human CASR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASR Products
Required fields are marked with *
My Review for All CASR Products
Required fields are marked with *
0
Inquiry Basket