Recombinant Human CASR protein, His-tagged
| Cat.No. : | CASR-3685H |
| Product Overview : | Recombinant Human CASR protein(279-604 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 11, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 279-604 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CASR calcium-sensing receptor [ Homo sapiens ] |
| Official Symbol | CASR |
| Synonyms | CASR; calcium-sensing receptor; HHC, HHC1, hypocalciuric hypercalcemia 1; extracellular calcium-sensing receptor; FHH; GPRC2A; NSHPT; severe neonatal hyperparathyroidism; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; CAR; FIH; HHC; EIG8; HHC1; PCAR1; MGC138441; |
| Gene ID | 846 |
| mRNA Refseq | NM_000388 |
| Protein Refseq | NP_000379 |
| UniProt ID | P41180 |
| ◆ Recombinant Proteins | ||
| CASR-23H | Recombinant Human CASR Protein (Y20-S1078 end), N-HA/Flag and C-10×His-tagged | +Inquiry |
| CASR-2757H | Recombinant Human CASR protein(871-1070 aa), C-His-tagged | +Inquiry |
| CASR-1036HFL | Recombinant Human CASR protein, His&Flag-tagged | +Inquiry |
| CASR-3685H | Recombinant Human CASR protein, His-tagged | +Inquiry |
| CASR-0439H | Recombinant Human CASR Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASR-7825HCL | Recombinant Human CASR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASR Products
Required fields are marked with *
My Review for All CASR Products
Required fields are marked with *
