Recombinant Human CASR Protein, His tagged
Cat.No. : | CASR-49H |
Product Overview : | Recombinant Human CASR Protein with His tag was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a plasma membrane G protein-coupled receptor that senses small changes in circulating calcium concentration. The encoded protein couples this information to intracellular signaling pathways that modify parathyroid hormone secretion or renal cation handling, and thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene are a cause of familial hypocalciuric hypercalcemia, neonatal severe hyperparathyroidism, and autosomal dominant hypocalcemia. |
Molecular Mass : | The protein has a calculated MW of 67 kDa. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.62 mg/mL |
Storage Buffer : | Sterile 20 mM Tris, 100 mM NaCl, 5 mM EDTA, pH 8.0 |
Gene Name | CASR calcium-sensing receptor [ Homo sapiens ] |
Official Symbol | CASR |
Synonyms | CASR; calcium-sensing receptor; HHC, HHC1, hypocalciuric hypercalcemia 1; extracellular calcium-sensing receptor; FHH; GPRC2A; NSHPT; severe neonatal hyperparathyroidism; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; CAR; FIH; HHC; EIG8; HHC1; PCAR1; MGC138441; |
Gene ID | 846 |
mRNA Refseq | NM_000388 |
Protein Refseq | NP_000379 |
MIM | 601199 |
UniProt ID | P41180 |
◆ Recombinant Proteins | ||
CASR-1148R | Recombinant Rat CASR Protein | +Inquiry |
CASR-0502H | Recombinant Human CASR Protein (Y20-S1078 end), Flag, 10×His tagged | +Inquiry |
CASR-27796TH | Recombinant Human CASR | +Inquiry |
Casr-6838R | Recombinant Rat Casr Protein (Lys863-Ser1079), N-His tagged | +Inquiry |
Casr-651M | Recombinant Mouse Casr Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASR-7825HCL | Recombinant Human CASR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASR Products
Required fields are marked with *
My Review for All CASR Products
Required fields are marked with *
0
Inquiry Basket