Recombinant Human CAST
Cat.No. : | CAST-27210TH |
Product Overview : | Recombinant fragment corresponding to amino acids 582-669 of Human Calpastatin with an N terminal proprietary tag; Predicted MWt 35.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 88 amino acids |
Description : | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Weight : | 35.310kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ |
Sequence Similarities : | Belongs to the protease inhibitor I27 (calpastatin) family. |
Gene Name | CAST calpastatin [ Homo sapiens ] |
Official Symbol | CAST |
Synonyms | CAST; calpastatin; |
Gene ID | 831 |
mRNA Refseq | NM_001042440 |
Protein Refseq | NP_001035905 |
MIM | 114090 |
Uniprot ID | P20810 |
Chromosome Location | 5q14-q22 |
Function | calcium-dependent cysteine-type endopeptidase inhibitor activity; endopeptidase inhibitor activity; protein binding; |
◆ Recombinant Proteins | ||
CAST-628H | Recombinant Human CAST Protein, His&GST-tagged | +Inquiry |
CAST-2751HF | Recombinant Full Length Human CAST Protein, GST-tagged | +Inquiry |
CAST-807R | Recombinant Rat CAST Protein, His (Fc)-Avi-tagged | +Inquiry |
CAST-50HF | Recombinant Full Length Human CAST Protein | +Inquiry |
CAST-1363H | Recombinant Human CAST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAST-7824HCL | Recombinant Human CAST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAST Products
Required fields are marked with *
My Review for All CAST Products
Required fields are marked with *