Recombinant Human Cbl proto oncogene Protein, His tagged
| Cat.No. : | CBL-001H |
| Product Overview : | Recombinant Human CBL Protein with His tag was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 775-906 aa |
| Description : | This gene is a proto-oncogene that encodes a RING finger E3 ubiquitin ligase. The encoded protein is one of the enzymes required for targeting substrates for degradation by the proteasome. This protein mediates the transfer of ubiquitin from ubiquitin conjugating enzymes (E2) to specific substrates. This protein also contains an N-terminal phosphotyrosine binding domain that allows it to interact with numerous tyrosine-phosphorylated substrates and target them for proteasome degradation. As such it functions as a negative regulator of many signal transduction pathways. This gene has been found to be mutated or translocated in many cancers including acute myeloid leukaemia, and expansion of CGG repeats in the 5'' UTR has been associated with Jacobsen syndrome. Mutations in this gene are also the cause of Noonan syndrome-like disorder. |
| Tag : | C-His |
| Molecular Mass : | 15 kDa |
| AA Sequence : | MDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVATHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH8.3 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | CBL Cbl proto-oncogene [ Homo sapiens (human) ] |
| Official Symbol | CBL |
| Synonyms | CBL; Cbl proto-oncogene, E3 ubiquitin protein ligase; Cas Br M (murine) ecotropic retroviral transforming sequence, CBL2; E3 ubiquitin-protein ligase CBL; c Cbl; oncogene CBL2; RNF55; proto-oncogene c-Cbl; RING finger protein 55; signal transduction protein CBL; casitas B-lineage lymphoma proto-oncogene; Cas-Br-M (murine) ecotropic retroviral transforming sequence; CBL2; NSLL; C-CBL |
| Gene ID | 867 |
| mRNA Refseq | NM_005188 |
| Protein Refseq | NP_005179 |
| MIM | 165360 |
| UniProt ID | P22681 |
| ◆ Recombinant Proteins | ||
| CBL-26493TH | Recombinant Human CBL | +Inquiry |
| CBL-2766HF | Recombinant Full Length Human CBL Protein, GST-tagged | +Inquiry |
| CBL-5782C | Recombinant Chicken CBL | +Inquiry |
| CBL-2779M | Recombinant Mouse CBL Protein | +Inquiry |
| CBL-001H | Recombinant Human Cbl proto oncogene Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CBL-287HCL | Recombinant Human CBL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBL Products
Required fields are marked with *
My Review for All CBL Products
Required fields are marked with *
