Recombinant Human Cbl proto oncogene Protein, His tagged

Cat.No. : CBL-001H
Product Overview : Recombinant Human CBL Protein with His tag was expressed in E. coli.
Availability November 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 775-906 aa
Description : This gene is a proto-oncogene that encodes a RING finger E3 ubiquitin ligase. The encoded protein is one of the enzymes required for targeting substrates for degradation by the proteasome. This protein mediates the transfer of ubiquitin from ubiquitin conjugating enzymes (E2) to specific substrates. This protein also contains an N-terminal phosphotyrosine binding domain that allows it to interact with numerous tyrosine-phosphorylated substrates and target them for proteasome degradation. As such it functions as a negative regulator of many signal transduction pathways. This gene has been found to be mutated or translocated in many cancers including acute myeloid leukaemia, and expansion of CGG repeats in the 5'' UTR has been associated with Jacobsen syndrome. Mutations in this gene are also the cause of Noonan syndrome-like disorder.
Tag : C-His
Molecular Mass : 15 kDa
AA Sequence : MDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVATHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH8.3
Concentration : 1 mg/mL by BCA
Gene Name CBL Cbl proto-oncogene [ Homo sapiens (human) ]
Official Symbol CBL
Synonyms CBL; Cbl proto-oncogene, E3 ubiquitin protein ligase; Cas Br M (murine) ecotropic retroviral transforming sequence, CBL2; E3 ubiquitin-protein ligase CBL; c Cbl; oncogene CBL2; RNF55; proto-oncogene c-Cbl; RING finger protein 55; signal transduction protein CBL; casitas B-lineage lymphoma proto-oncogene; Cas-Br-M (murine) ecotropic retroviral transforming sequence; CBL2; NSLL; C-CBL
Gene ID 867
mRNA Refseq NM_005188
Protein Refseq NP_005179
MIM 165360
UniProt ID P22681

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBL Products

Required fields are marked with *

My Review for All CBL Products

Required fields are marked with *

0
cart-icon
0
compare icon