Recombinant Human CCBL1 protein, GST-tagged
| Cat.No. : | CCBL1-6744H |
| Product Overview : | Recombinant Human CCBL1 protein(201-374 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 201-374 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | ATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | CCBL1 cysteine conjugate-beta lyase, cytoplasmic [ Homo sapiens ] |
| Official Symbol | CCBL1 |
| Synonyms | CCBL1; cysteine conjugate-beta lyase, cytoplasmic; cysteine conjugate beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); kynurenine--oxoglutarate transaminase 1; glutamine transaminase K; GTK; KATI; kyneurenine aminotransferase; beta-lysase, kidney; kynurenine aminotransferase I; cysteine-S-conjugate beta-lyase; glutamine--phenylpyruvate transaminase; kynurenine--oxoglutarate transaminase I; glutamine-phenylpyruvate aminotransferase; cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); KAT1; FLJ95217; MGC29624; |
| mRNA Refseq | NM_001122671 |
| Protein Refseq | NP_001116143 |
| MIM | 600547 |
| UniProt ID | Q16773 |
| Gene ID | 883 |
| ◆ Recombinant Proteins | ||
| CCBL1-6744H | Recombinant Human CCBL1 protein, GST-tagged | +Inquiry |
| CCBL1-387H | Recombinant Human CCBL1, T7-tagged | +Inquiry |
| CCBL1-12539Z | Recombinant Zebrafish CCBL1 | +Inquiry |
| CCBL1-0492H | Recombinant Human CCBL1 Protein, GST-Tagged | +Inquiry |
| CCBL1-1166R | Recombinant Rat CCBL1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCBL1-7796HCL | Recombinant Human CCBL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCBL1 Products
Required fields are marked with *
My Review for All CCBL1 Products
Required fields are marked with *
