Recombinant Human CCBL1 Protein, GST-Tagged
| Cat.No. : | CCBL1-0492H |
| Product Overview : | Human CCBL1 full-length ORF (AAH33685, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 66.88 kDa |
| AA Sequence : | MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCBL1 cysteine conjugate-beta lyase, cytoplasmic [ Homo sapiens ] |
| Official Symbol | CCBL1 |
| Synonyms | CCBL1; cysteine conjugate-beta lyase, cytoplasmic; cysteine conjugate beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); kynurenine--oxoglutarate transaminase 1; glutamine transaminase K; GTK; KATI; kyneurenine aminotransferase; beta-lysase, kidney; kynurenine aminotransferase I; cysteine-S-conjugate beta-lyase; glutamine--phenylpyruvate transaminase; kynurenine--oxoglutarate transaminase I; glutamine-phenylpyruvate aminotransferase; cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); KAT1; FLJ95217; MGC29624; |
| Gene ID | 883 |
| mRNA Refseq | NM_001122671 |
| Protein Refseq | NP_001116143 |
| MIM | 600547 |
| UniProt ID | Q16773 |
| ◆ Recombinant Proteins | ||
| CCBL1-387H | Recombinant Human CCBL1, T7-tagged | +Inquiry |
| CCBL1-1166R | Recombinant Rat CCBL1 Protein | +Inquiry |
| CCBL1-2800HF | Recombinant Full Length Human CCBL1 Protein, GST-tagged | +Inquiry |
| CCBL1-12539Z | Recombinant Zebrafish CCBL1 | +Inquiry |
| CCBL1-82H | Recombinant Human CCBL1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCBL1-7796HCL | Recombinant Human CCBL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCBL1 Products
Required fields are marked with *
My Review for All CCBL1 Products
Required fields are marked with *
