Recombinant Human CCDC148 Protein, GST-Tagged
| Cat.No. : | CCDC148-0531H | 
| Product Overview : | Human CCDC148 full-length ORF (AAH15395.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | CCDC148 (Coiled-Coil Domain Containing 148) is a Protein Coding gene. | 
| Molecular Mass : | 56.7 kDa | 
| AA Sequence : | MCAASASPDNLVFHMKNEMRNIKYKPVDYQQLRALTEAKKLASASAKLKIRKAMLTSKLSKEQTLIKQHKQVWWQEYQRLNEVRCKMESEIKSLLNEENIGNECLCDLTNFEQELSEQQCTYLKNVINPIQQLRADLKYRQHHTLQHSHPHIEFNSVKVLEEVDFVKKQLKTVFERLRLEQQRIENDLSDWSIKILDHSLEEKTNPLSELPIELESLECPYPDLKSSILSEFYKFTQKYQKKLQDFNLQLEDIYR | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CCDC148 coiled-coil domain containing 148 [ Homo sapiens ] | 
| Official Symbol | CCDC148 | 
| Synonyms | CCDC148; coiled-coil domain containing 148; coiled-coil domain-containing protein 148; MGC125588; MGC125590; | 
| Gene ID | 130940 | 
| mRNA Refseq | NM_001171637 | 
| Protein Refseq | NP_001165108 | 
| UniProt ID | Q8NFR7 | 
| ◆ Recombinant Proteins | ||
| CCDC148-2840HF | Recombinant Full Length Human CCDC148 Protein, GST-tagged | +Inquiry | 
| CCDC148-0531H | Recombinant Human CCDC148 Protein, GST-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CCDC148-998HCL | Recombinant Human CCDC148 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC148 Products
Required fields are marked with *
My Review for All CCDC148 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            