Recombinant Human CCL16 Protein, GST-Tagged
| Cat.No. : | CCL16-0613H |
| Product Overview : | Human CCL16 partial ORF (NP_004581.1, 25 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | PKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ] |
| Official Symbol | CCL16 |
| Synonyms | CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051; |
| Gene ID | 6360 |
| mRNA Refseq | NM_004590 |
| Protein Refseq | NP_004581 |
| MIM | 601394 |
| UniProt ID | O15467 |
| ◆ Recombinant Proteins | ||
| CCL16-29941TH | Recombinant Human CCL16 | +Inquiry |
| CCL16-3698H | Recombinant Human CCL16 protein, rFc-tagged | +Inquiry |
| CCL16-242H | Recombinant Human CCL16 protein, His-tagged | +Inquiry |
| CCL16-268C | Active Recombinant Human CCL16 Protein (97 aa) | +Inquiry |
| CCL16-07H | Recombinant Human CCL16 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL16-7730HCL | Recombinant Human CCL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL16 Products
Required fields are marked with *
My Review for All CCL16 Products
Required fields are marked with *
