Recombinant Human CCL19 Protein
Cat.No. : | CCL19-013H |
Product Overview : | Recombinant human CCL19 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 98 |
Description : | This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. |
Form : | Lyophilized |
AA Sequence : | MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
Purity : | > 97% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens (human) ] |
Official Symbol | CCL19 |
Synonyms | CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433; |
Gene ID | 6363 |
mRNA Refseq | NM_006274 |
Protein Refseq | NP_006265 |
MIM | 602227 |
UniProt ID | Q99731 |
◆ Recombinant Proteins | ||
Ccl19-723R | Recombinant Rat Ccl19 protein, His-tagged | +Inquiry |
CCL19-2936HF | Recombinant Full Length Human CCL19 Protein, GST-tagged | +Inquiry |
CCL19-1112H | Recombinant Horse CCL19 Protein, His-tagged | +Inquiry |
CCL19-119C | Recombinant Cynomolgus Monkey CCL19 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL19-682R | Recombinant Rhesus monkey CCL19 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL19 Products
Required fields are marked with *
My Review for All CCL19 Products
Required fields are marked with *
0
Inquiry Basket