Recombinant Human CCL25 Protein, GST-Tagged
| Cat.No. : | CCL25-0630H |
| Product Overview : | Human CCL25 partial ORF (NP_005615, 24 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ] |
| Official Symbol | CCL25 |
| Synonyms | CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327; |
| Gene ID | 6370 |
| mRNA Refseq | NM_001201359 |
| Protein Refseq | NP_001188288 |
| MIM | 602565 |
| UniProt ID | O15444 |
| ◆ Recombinant Proteins | ||
| CCL25-203H | Recombinant Human CCL25 protein, Fc-tagged | +Inquiry |
| Ccl25-1265R | Recombinant Rat Ccl25 Protein, His-tagged | +Inquiry |
| CCL25-201H | Active Recombinant Human CCL25 protein, Fc-tagged | +Inquiry |
| CCL25-220H | Active Recombinant Human CCL25, Met-tagged | +Inquiry |
| Ccl25-2035M | Active Recombinant Mouse Ccl25 Protein | +Inquiry |
| ◆ Native Proteins | ||
| CCL25-31214TH | Native Human CCL25 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL25-7726HCL | Recombinant Human CCL25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL25 Products
Required fields are marked with *
My Review for All CCL25 Products
Required fields are marked with *
