Recombinant Human CCL3 protein
Cat.No. : | CCL3-291H |
Product Overview : | Recombinant Human CCL3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 70 |
Description : | CCL3, also known as macrophage inflammatory protein-1α (MIP-1α), is a cytokine belonging to the CC chemokine family that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes. Studies showed CCL3 can bind to CCR1, CCR4 and CCR5. MIP-1α can induce a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Recombinant human MIP-1α is a 7.8 kDa protein containing 69 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines and it shares approximately 73 %, 74 % and 92 % amino acid sequence homology with the murine, rat and rhesus macaque protein. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : | Approximately 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines. |
AA Sequence : | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
Endotoxin : | Less than 1 EU/μg of rHuMIP-1α/CCL3 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL3 |
Official Symbol | CCL3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha; |
Gene ID | 6348 |
mRNA Refseq | NM_002983 |
Protein Refseq | NP_002974 |
MIM | 182283 |
UniProt ID | P10147 |
◆ Recombinant Proteins | ||
CCL3-169H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
Ccl3-2037M | Active Recombinant Mouse Ccl3 Protein | +Inquiry |
CCL3-021H | Recombinant Human CCL3 Protein, Biotinylated | +Inquiry |
Ccl3-132M | Active Recombinant Mouse Ccl3 Protein | +Inquiry |
CCL3-020H | Recombinant Human CCL3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *
0
Inquiry Basket