Recombinant Human CCL3L3, His-tagged
Cat.No. : | CCL3L3-29221TH |
Product Overview : | Recombinant full length Human LD78 beta with N terminal His tag; 90 amino acids with tag, Predicted MWt 10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 68 amino acids |
Description : | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein binds to several chemokine receptors including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals; most individuals have 1-6 copies in the diploid genome, although rare individuals have zero or more than six copies. The human genome reference assembly contains two full copies of the gene (CCL3L3 and CCL3L1) and a partial pseudogene. This record represents the more centromeric full-length gene. |
Conjugation : | HIS |
Molecular Weight : | 10.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Gene Name | CCL3L3 chemokine (C-C motif) ligand 3-like 3 [ Homo sapiens ] |
Official Symbol | CCL3L3 |
Synonyms | CCL3L3; chemokine (C-C motif) ligand 3-like 3; C-C motif chemokine 3-like 1; MGC12815; |
Gene ID | 414062 |
mRNA Refseq | NM_001001437 |
Protein Refseq | NP_001001437 |
MIM | 609468 |
Uniprot ID | P16619 |
Chromosome Location | 17q21.1 |
Pathway | Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; |
Function | chemokine activity; |
◆ Recombinant Proteins | ||
CCL3L3-29221TH | Recombinant Human CCL3L3, His-tagged | +Inquiry |
CCL3L3-29222TH | Recombinant Human CCL3L3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3L3-169HCL | Recombinant Human CCL3L3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3L3 Products
Required fields are marked with *
My Review for All CCL3L3 Products
Required fields are marked with *