Recombinant Human CCL4 Protein, Biotinylated
Cat.No. : | CCL4-023H |
Product Overview : | Biotinylated Recombinant human CCL4 protein was tag free expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 92 |
Description : | The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. |
Form : | Lyophilized |
AA Sequence : | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
Purity : | > 97% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Conjugation : | Biotin |
Gene Name | CCL4 chemokine (C-C motif) ligand 4 [ Homo sapiens (human) ] |
Official Symbol | CCL4 |
Synonyms | CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026; |
Gene ID | 6351 |
mRNA Refseq | NM_002984 |
Protein Refseq | NP_002975 |
MIM | 182284 |
UniProt ID | P13236 |
◆ Recombinant Proteins | ||
CCL4-16H | Active Recombinant Human CCL4 | +Inquiry |
CCL4-022H | Recombinant Human CCL4 Protein | +Inquiry |
CCL4-294H | Recombinant Human CCL4 protein | +Inquiry |
CCL4-269H | Active Recombinant Human CCL4 Protein (Ala24-Asn92), Animal-free, Carrier-free | +Inquiry |
CCL4-79H | Recombinant Human CCL4 Protein, Biotin-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL4 Products
Required fields are marked with *
My Review for All CCL4 Products
Required fields are marked with *