Recombinant Mouse Ccl4 protein
Cat.No. : | Ccl4-615M |
Product Overview : | Recombinant Mouse Ccl4 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 69 |
Description : | Chemokine (C-C motif) ligand 4, also known as Macrophage inflammatory protein-1β (MIP-1β) is a CC chemokine with specificity for CCR5 receptors and it is a major HIV-suppressive factor produced by CD8+ T cells. In addition, it is a monokine with inflammatory and chemokinetic properties. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Furthermore, recombinant murine CCL4 contains 69 amino acids and it shares 77 % and 86 % a.a. sequence identity with human and rat CCL4. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 20-100 ng/ml. |
Molecular Mass : | Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
AA Sequence : | APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN |
Endotoxin : | Less than 1 EU/µg of rMuMIP-1β/CCL4 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl4 |
Official Symbol | Ccl4 |
Synonyms | CCL4; chemokine (C-C motif) ligand 4; C-C motif chemokine 4; ACT2; SIS-gamma; MIP-1 beta; MIP-1-beta; immune activation protein 2; small inducible cytokine A4; small-inducible cytokine A4; macrophage inflammatory protein 1-beta; Act-2; Mip1b; Scya4; MIP-1B; AT744.1; |
Gene ID | 20303 |
mRNA Refseq | NM_013652 |
Protein Refseq | NP_038680 |
UniProt ID | P14097 |
◆ Recombinant Proteins | ||
CCL4-934R | Recombinant Rat CCL4 Protein (Ala24-Asn92), His-tagged | +Inquiry |
Ccl4-105M | Recombinant Murine Chemokine (C-C Motif) Ligand 4 | +Inquiry |
Ccl4-386C | Active Recombinant Cotton Rat Ccl4 | +Inquiry |
CCL4-137C | Recombinant Chicken Chemokine (C-C motif) Ligand 4 | +Inquiry |
CCL4-74R | Recombinant Rat CCL4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl4 Products
Required fields are marked with *
My Review for All Ccl4 Products
Required fields are marked with *
0
Inquiry Basket