Recombinant Human CCL5 protein
Cat.No. : | CCL5-301H |
Product Overview : | Recombinant Human CCL5 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 68 |
Description : | Chemokine (C-C motif) ligand 5 (CCL5) also known as RANTES is classified as a chemotactic cytokine or chemokine. It is encoded by the CCL5 gene in humans. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites which has been reported to be produced by renal tubular epithelium, synovial fibroblasts and selected tumor cells. It also induces the proliferation and activation of certain natural-killer cells to form CHAK cells. Recombinant human CCL5 contains 68 amino acids and it shares 84 % a.a. sequence identity with murine and rat CCL5, respectively. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : | Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids. |
AA Sequence : | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Endotoxin : | Less than 1 EU/μg of rHuRANTES/CCL5 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL5 |
Official Symbol | CCL5 |
Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E; |
Gene ID | 6352 |
mRNA Refseq | NM_002985 |
Protein Refseq | NP_002976 |
MIM | 187011 |
UniProt ID | P13501 |
◆ Recombinant Proteins | ||
CCL5-521R | Recombinant Rhesus Macaque CCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL5-427F | Recombinant Feline CCL5 Protein | +Inquiry |
CCL5-61H | Recombinant Human chemokine (C-C motif) ligand 5, His-tagged | +Inquiry |
CCL5-032H | Recombinant Human CCL5 Protein, Biotinylated | +Inquiry |
CCL5-125H | Recombinant Human Chemokine (C-C Motif) Ligand 5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *
0
Inquiry Basket