Recombinant Human CCL5 Protein, Biotinylated
| Cat.No. : | CCL5-032H |
| Product Overview : | Biotinylated Recombinant human CCL5 protein was tag free expressed. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Protein Length : | 91 |
| Description : | This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. |
| Form : | Lyophilized |
| AA Sequence : | MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Purity : | > 97% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Conjugation : | Biotin |
| Gene Name | CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens (human) ] |
| Official Symbol | CCL5 |
| Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E; |
| Gene ID | 6352 |
| mRNA Refseq | NM_002985 |
| Protein Refseq | NP_002976 |
| MIM | 187011 |
| UniProt ID | P13501 |
| ◆ Recombinant Proteins | ||
| Ccl5-774M | Recombinant Mouse Ccl5 protein, His & GST-tagged | +Inquiry |
| CCL5-3492C | Recombinant Chicken CCL5 | +Inquiry |
| CCL5-1068HFL | Active Recombinant Full Length Human CCL5 Protein, C-Flag-tagged | +Inquiry |
| CCL5-775P | Recombinant Pig CCL5 protein, His & T7-tagged | +Inquiry |
| CCL5-4353R | Recombinant Rabbit CCL5 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *



