Recombinant Human CCL5 protein, His-tagged
| Cat.No. : | CCL5-6111H |
| Product Overview : | Recombinant Human CCL5 protein(25-91 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-91 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Gene Name | CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens ] |
| Official Symbol | CCL5 |
| Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E; |
| Gene ID | 6352 |
| mRNA Refseq | NM_002985 |
| Protein Refseq | NP_002976 |
| MIM | 187011 |
| UniProt ID | P13501 |
| ◆ Recombinant Proteins | ||
| CCL5-510H | Active Recombinant Mouse Chemokine (C-C motif) Ligand 5, MIgG2a Fc-tagged | +Inquiry |
| Ccl5-7685M | Recombinant Mouse Ccl5 protein, hFc-tagged | +Inquiry |
| CCL5-61H | Recombinant Human chemokine (C-C motif) ligand 5, His-tagged | +Inquiry |
| CCL5-3993HFL | Recombinant Full Length Human CCL5 protein, Flag-tagged | +Inquiry |
| CCL5-770D | Recombinant Dog CCL5 protein, His & S-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *



