Recombinant Human CCL8 protein, GST-tagged
Cat.No. : | CCL8-30121H |
Product Overview : | Recombinant Human CCL8 (22-99 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro22-99Pro |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
Gene Name | CCL8 chemokine (C-C motif) ligand 8 [ Homo sapiens ] |
Official Symbol | CCL8 |
Synonyms | CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10; |
Gene ID | 6355 |
mRNA Refseq | NM_005623 |
Protein Refseq | NP_005614 |
MIM | 602283 |
UniProt ID | P80075 |
◆ Recombinant Proteins | ||
CCL8-34H | Recombinant Human CCL8 Protein | +Inquiry |
CCL8-336C | Active Recombinant Human CCL8 Protein (76 aa) | +Inquiry |
Ccl8-2042M | Active Recombinant Mouse Ccl8 Protein | +Inquiry |
CCL8-032H | Recombinant Human CCL8 Protein, DDK-tagged | +Inquiry |
CCL8-1266H | Recombinant Human CCL8 Protein (Gln24-Pro99), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL8 Products
Required fields are marked with *
My Review for All CCL8 Products
Required fields are marked with *
0
Inquiry Basket