Recombinant Human CCNB2, His-tagged

• Cat.No.: CCNB2-27516TH
• Product Overview: Recombinant fragment, corresponding to amino acids 214-396 of Human Cyclin B2 with N terminal His tag; 183 amino acids, 21kDa.

Specification

• Description: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 119 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLI LKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLM ELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQY YTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYA SSKLLKISMIPQLNSKAVKDLASPLIG

Gene Information

• Gene Name: CCNB2 cyclin B2 [ Homo sapiens ]
• Official Symbol: CCNB2
• Synonyms: CCNB2; cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299
• Gene ID: 9133
• mRNA Refseq: NM_004701
• Protein Refseq: NP_004692
• MIM: 602755
• Uniprot ID: O95067
• Chromosome Location: 15q21.3
• Pathway: Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem
• Function: protein kinase binding