Recombinant Human CCNB2, His-tagged
Cat.No. : | CCNB2-27516TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 214-396 of Human Cyclin B2 with N terminal His tag; 183 amino acids, 21kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 214-396 a.a. |
Description : | Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 119 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLI LKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLM ELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQY YTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYA SSKLLKISMIPQLNSKAVKDLASPLIG |
Gene Name | CCNB2 cyclin B2 [ Homo sapiens ] |
Official Symbol | CCNB2 |
Synonyms | CCNB2; cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299; |
Gene ID | 9133 |
mRNA Refseq | NM_004701 |
Protein Refseq | NP_004692 |
MIM | 602755 |
Uniprot ID | O95067 |
Chromosome Location | 15q21.3 |
Pathway | Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; |
Function | protein kinase binding; |
◆ Recombinant Proteins | ||
CCNB2-1402M | Recombinant Mouse CCNB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNB2-374C | Recombinant Cynomolgus CCNB2 Protein, His-tagged | +Inquiry |
CCNB2-10858H | Recombinant Human CCNB2, His-tagged | +Inquiry |
CCNB2-27516TH | Recombinant Human CCNB2, His-tagged | +Inquiry |
CCNB2-0895H | Recombinant Human CCNB2 Protein (Val58-Ser398), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB2-7716HCL | Recombinant Human CCNB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNB2 Products
Required fields are marked with *
My Review for All CCNB2 Products
Required fields are marked with *
0
Inquiry Basket