Recombinant Human CCNB2, His-tagged

Cat.No. : CCNB2-27516TH
Product Overview : Recombinant fragment, corresponding to amino acids 214-396 of Human Cyclin B2 with N terminal His tag; 183 amino acids, 21kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 214-396 a.a.
Description : Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 119 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLI LKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLM ELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQY YTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYA SSKLLKISMIPQLNSKAVKDLASPLIG
Gene Name CCNB2 cyclin B2 [ Homo sapiens ]
Official Symbol CCNB2
Synonyms CCNB2; cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299;
Gene ID 9133
mRNA Refseq NM_004701
Protein Refseq NP_004692
MIM 602755
Uniprot ID O95067
Chromosome Location 15q21.3
Pathway Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem;
Function protein kinase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCNB2 Products

Required fields are marked with *

My Review for All CCNB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon