Recombinant Human CCND1, His-tagged
Cat.No. : | CCND1-27520TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-295 of Human Cyclin D1, with N terminal His tag, 295 amino acids. In addition to the coding region for Cyclin D1 this protein carries the following N-terminal sequence: MRGSHHHHHHGSYLGDTIESST |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-295 a.a. |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 87 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAP SVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVF PLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKET IPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMT PHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVK FISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRF LSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI |
Sequence Similarities : | Belongs to the cyclin family. Cyclin D subfamily. |
Full Length : | Full L. |
Gene Name | CCND1 cyclin D1 [ Homo sapiens ] |
Official Symbol | CCND1 |
Synonyms | CCND1; cyclin D1; BCL1, cyclin D1 (PRAD1: parathyroid adenomatosis 1) , D11S287E, PRAD1; G1/S-specific cyclin-D1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; |
Gene ID | 595 |
mRNA Refseq | NM_053056 |
Protein Refseq | NP_444284 |
MIM | 168461 |
Uniprot ID | P24385 |
Chromosome Location | 11q13 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; |
Function | cyclin-dependent protein kinase regulator activity; enzyme binding; protein binding; protein kinase activity; protein kinase binding; |
◆ Recombinant Proteins | ||
IGLC1-6754H | Recombinant Human IGLC1 protein, His-tagged | +Inquiry |
IGLC1-4643H | Recombinant Human IGLC1 protein, His-SUMO-tagged | +Inquiry |
CCND1-1492H | Recombinant Human CCND1 protein, GST-tagged | +Inquiry |
CCND1-2609C | Recombinant Chicken CCND1 protein, His-tagged | +Inquiry |
CCND1-31773TH | Recombinant Human Human CDK6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND1-7713HCL | Recombinant Human CCND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND1 Products
Required fields are marked with *
My Review for All CCND1 Products
Required fields are marked with *