Recombinant Human CCND1 protein, GST-tagged
Cat.No. : | CCND1-1492H |
Product Overview : | Recombinant Human CCND1 protein(1-42 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 1-42 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSV |
Gene Name | CCND1 cyclin D1 (PRAD1: parathyroid adenomatosis 1) [ Homo sapiens ] |
Official Symbol | CCND1 |
Synonyms | CCND1; cyclin D1 (PRAD1: parathyroid adenomatosis 1); BCL1, cyclin D1 (PRAD1: parathyroid adenomatosis 1) , D11S287E, PRAD1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; BCL-1; PRAD1; D11S287E; |
Gene ID | 893 |
MIM | 168461 |
UniProt ID | P24385 |
◆ Recombinant Proteins | ||
IGLC1-6754H | Recombinant Human IGLC1 protein, His-tagged | +Inquiry |
CCND1-354H | Recombinant Human CCND1 protein, His/MBP-tagged | +Inquiry |
CCND1-3659H | Recombinant Human CCND1 protein, His-tagged | +Inquiry |
CCND1-877R | Recombinant Rat CCND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND1-1493H | Recombinant Human CCND1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND1-7713HCL | Recombinant Human CCND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND1 Products
Required fields are marked with *
My Review for All CCND1 Products
Required fields are marked with *