Recombinant Human CCND1 protein, T7/His-tagged
| Cat.No. : | CCND1-221H |
| Product Overview : | Recombinant human cDNA (294aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGEFEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCV QKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEK LCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISN PPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEE EEEEEEEVDLACTPTDVRDVDI |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | CCND1 cyclin D1 (PRAD1: parathyroid adenomatosis 1) [ Homo sapiens ] |
| Official Symbol | CCND1 |
| Synonyms | CCND1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; BCL-1; PRAD1; D11S287E; |
| Gene ID | 893 |
| mRNA Refseq | |
| Protein Refseq | |
| MIM | 168461 |
| UniProt ID | P24385 |
| Chromosome Location | 11q13 |
| ◆ Recombinant Proteins | ||
| CCND1-3824HFL | Recombinant Full Length Human CCND1 protein, Flag-tagged | +Inquiry |
| CCND1-1492H | Recombinant Human CCND1 protein, GST-tagged | +Inquiry |
| CCND1-6933C | Recombinant Chicken CCND1 | +Inquiry |
| CCND1-2967HF | Recombinant Full Length Human CCND1 Protein, GST-tagged | +Inquiry |
| CCND1-354H | Recombinant Human CCND1 protein, His/MBP-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCND1-7713HCL | Recombinant Human CCND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND1 Products
Required fields are marked with *
My Review for All CCND1 Products
Required fields are marked with *
