Recombinant Human CCND1 protein, T7/His-tagged
Cat.No. : | CCND1-221H |
Product Overview : | Recombinant human cDNA (294aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGEFEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCV QKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEK LCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISN PPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEE EEEEEEEVDLACTPTDVRDVDI |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | CCND1 cyclin D1 (PRAD1: parathyroid adenomatosis 1) [ Homo sapiens ] |
Official Symbol | CCND1 |
Synonyms | CCND1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; BCL-1; PRAD1; D11S287E; |
Gene ID | 893 |
mRNA Refseq | |
Protein Refseq | |
MIM | 168461 |
UniProt ID | P24385 |
Chromosome Location | 11q13 |
◆ Recombinant Proteins | ||
CCND1-27520TH | Recombinant Human CCND1, His-tagged | +Inquiry |
CCND1-2608C | Recombinant Cattle CCND1 protein, His & T7-tagged | +Inquiry |
CCND1-23H | Recombinant Human CCND1 protein, MYC/DDK-tagged | +Inquiry |
IGLC1-7325H | Recombinant Human IGLC1 protein, His-tagged | +Inquiry |
CCND1-6933C | Recombinant Chicken CCND1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND1-7713HCL | Recombinant Human CCND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCND1 Products
Required fields are marked with *
My Review for All CCND1 Products
Required fields are marked with *
0
Inquiry Basket