Recombinant Human CCND2 Protein, C-His/Avi tagged, Biotinylated
Cat.No. : | CCND2-001HB |
Product Overview : | Biotinylated Recombinant Human CCND2 Protein with C-His/Avi tag was expressed in HEK293. |
Availability | August 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3). |
Form : | Liquid |
Molecular Mass : | The protein has a calculated MW of 36 kDa. |
AA Sequence : | MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDLHHHHHHHHGLNDIFEAQKIEWHE |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.73 mg/mL |
Storage Buffer : | Liquid in sterile PBS, pH 7.4, 1% SKL |
Conjugation : | Biotin |
Gene Name | CCND2 cyclin D2 [ Homo sapiens ] |
Official Symbol | CCND2 |
Synonyms | CCND2; cyclin D2; G1/S-specific cyclin-D2; G1/S specific cyclin D2; G1/S-specific cyclin D2; KIAK0002; MGC102758; |
Gene ID | 894 |
mRNA Refseq | NM_001759 |
Protein Refseq | NP_001750 |
MIM | 123833 |
UniProt ID | P30279 |
◆ Recombinant Proteins | ||
CCND2-5787C | Recombinant Chicken CCND2 | +Inquiry |
CCND2-1404M | Recombinant Mouse CCND2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND2-10861H | Recombinant Human CCND2, GST-tagged | +Inquiry |
CCND2-2969HF | Recombinant Full Length Human CCND2 Protein, GST-tagged | +Inquiry |
CCND2-878R | Recombinant Rat CCND2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND2-7712HCL | Recombinant Human CCND2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND2 Products
Required fields are marked with *
My Review for All CCND2 Products
Required fields are marked with *