Recombinant Human CCNE2 Protein, GST-Tagged
Cat.No. : | CCNE2-0667H |
Product Overview : | Human CCNE2 full-length ORF (AAH20729, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 66.88 kDa |
AA Sequence : | MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLCMISSHV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNE2 cyclin E2 [ Homo sapiens ] |
Official Symbol | CCNE2 |
Synonyms | CCNE2; cyclin E2; G1/S-specific cyclin-E2; CYCE2; |
Gene ID | 9134 |
mRNA Refseq | NM_057749 |
Protein Refseq | NP_477097 |
MIM | 603775 |
UniProt ID | O96020 |
◆ Recombinant Proteins | ||
CCNE2-2774H | Recombinant Human CCNE2 protein, His-tagged | +Inquiry |
CCNE2-0667H | Recombinant Human CCNE2 Protein, GST-Tagged | +Inquiry |
CCNE2-3047H | Recombinant Human CCNE2 protein, His-tagged | +Inquiry |
CCNE2-180H | Recombinant Human CCNE2 protein, GST-tagged | +Inquiry |
CCNE2-10864H | Recombinant Human CCNE2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNE2-7709HCL | Recombinant Human CCNE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNE2 Products
Required fields are marked with *
My Review for All CCNE2 Products
Required fields are marked with *
0
Inquiry Basket