Recombinant Human CCNJL Protein (315-435 aa), His-tagged
Cat.No. : | CCNJL-1354H |
Product Overview : | Recombinant Human CCNJL Protein (315-435 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 315-435 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | CCNJL cyclin J-like [ Homo sapiens ] |
Official Symbol | CCNJL |
Synonyms | Ccnjl; CCNJL_HUMAN; Cyclin J like; FLJ14166; |
Gene ID | 79616 |
mRNA Refseq | NM_024565.5 |
Protein Refseq | NP_078841.3 |
UniProt ID | Q8IV13 |
◆ Recombinant Proteins | ||
Ccnjl-2049M | Recombinant Mouse Ccnjl Protein, Myc/DDK-tagged | +Inquiry |
CCNJL-10871H | Recombinant Human CCNJL, GST-tagged | +Inquiry |
CCNJL-4192H | Recombinant Human CCNJL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCNJL-3000M | Recombinant Mouse CCNJL Protein | +Inquiry |
CCNJL-1354H | Recombinant Human CCNJL Protein (315-435 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNJL-7702HCL | Recombinant Human CCNJL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNJL Products
Required fields are marked with *
My Review for All CCNJL Products
Required fields are marked with *