Recombinant Human CCNJL Protein (315-435 aa), His-tagged
| Cat.No. : | CCNJL-1354H |
| Product Overview : | Recombinant Human CCNJL Protein (315-435 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 315-435 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.9 kDa |
| AA Sequence : | MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | CCNJL cyclin J-like [ Homo sapiens ] |
| Official Symbol | CCNJL |
| Synonyms | Ccnjl; CCNJL_HUMAN; Cyclin J like; FLJ14166; |
| Gene ID | 79616 |
| mRNA Refseq | NM_024565.5 |
| Protein Refseq | NP_078841.3 |
| UniProt ID | Q8IV13 |
| ◆ Recombinant Proteins | ||
| CCNJL-10871H | Recombinant Human CCNJL, GST-tagged | +Inquiry |
| CCNJL-4247H | Recombinant Human CCNJL Protein, GST-tagged | +Inquiry |
| CCNJL-1412M | Recombinant Mouse CCNJL Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCNJL-3000M | Recombinant Mouse CCNJL Protein | +Inquiry |
| Ccnjl-2049M | Recombinant Mouse Ccnjl Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCNJL-7702HCL | Recombinant Human CCNJL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNJL Products
Required fields are marked with *
My Review for All CCNJL Products
Required fields are marked with *
