Recombinant Human CCNJL Protein, GST-tagged

Cat.No. : CCNJL-4247H
Product Overview : Human FLJ14166 full-length ORF ( AAH13353.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCNJL (Cyclin J Like) is a Protein Coding gene. An important paralog of this gene is CCNJ.
Molecular Mass : 39.3 kDa
AA Sequence : MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCNJL cyclin J-like [ Homo sapiens ]
Official Symbol CCNJL
Synonyms Ccnjl; CCNJL_HUMAN; Cyclin J like; Cyclin J like protein; Cyclin-J-like protein; FLJ14166;
Gene ID 79616
mRNA Refseq NM_024565
Protein Refseq NP_078841
UniProt ID Q8IV13

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCNJL Products

Required fields are marked with *

My Review for All CCNJL Products

Required fields are marked with *

0
cart-icon
0
compare icon