Recombinant Human CCNJL Protein, GST-tagged

• Cat.No.: CCNJL-4247H
• Product Overview: Human FLJ14166 full-length ORF ( AAH13353.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CCNJL (Cyclin J Like) is a Protein Coding gene. An important paralog of this gene is CCNJ.
• Molecular Mass: 39.3 kDa
• AA Sequence: MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCNJL cyclin J-like [ Homo sapiens ]
• Official Symbol: CCNJL
• Synonyms: Ccnjl; CCNJL_HUMAN; Cyclin J like; Cyclin J like protein; Cyclin-J-like protein; FLJ14166
• Gene ID: 79616
• mRNA Refseq: NM_024565
• Protein Refseq: NP_078841
• UniProt ID: Q8IV13