Recombinant Human CCR9 protein, GST-tagged
Cat.No. : | CCR9-5223H |
Product Overview : | Recombinant Human CCR9 protein(P51686)(1-48aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-48aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFAS |
Gene Name | CCR9 chemokine (C-C motif) receptor 9 [ Homo sapiens ] |
Official Symbol | CCR9 |
Synonyms | CCR9; chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9; |
Gene ID | 10803 |
mRNA Refseq | NM_001256369 |
Protein Refseq | NP_001243298 |
MIM | 604738 |
UniProt ID | P51686 |
◆ Recombinant Proteins | ||
CCR9-716H | Recombinant Human CCR9 | +Inquiry |
RFL35509MF | Recombinant Full Length Mouse C-C Chemokine Receptor Type 9(Ccr9) Protein, His-Tagged | +Inquiry |
CCR9-3032HF | Recombinant Full Length Human CCR9 Protein | +Inquiry |
CCR9-3960H | Recombinant Human CCR9 Protein, His tagged, Biotinylated | +Inquiry |
CCR9-1371H | Active Recombinant Human CCR9 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Native Proteins | ||
CCR9-13HCL | Recombinant Full Length Human CCR9 Over-expression Lysate, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR9-310HCL | Recombinant Human CCR9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR9 Products
Required fields are marked with *
My Review for All CCR9 Products
Required fields are marked with *