Recombinant Human CCR9 protein, GST-tagged

• Cat.No.: CCR9-5223H
• Product Overview: Recombinant Human CCR9 protein(P51686)(1-48aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: GST
• Protein length: 1-48aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.9 kDa
• AASequence: MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFAS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CCR9 chemokine (C-C motif) receptor 9 [ Homo sapiens ]
• Official Symbol: CCR9
• Synonyms: CCR9; chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9
• Gene ID: 10803
• mRNA Refseq: NM_001256369
• Protein Refseq: NP_001243298
• MIM: 604738
• UniProt ID: P51686