Recombinant Human CD14 Protein, C-His-tagged
Cat.No. : | CD14-179H |
Product Overview : | Recombinant Human CD14 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD14 is a leucine-rich repeat-containing pattern recognition receptor with expression largely restricted to the monocyte/macrophage cell lineage. Research studies have shown that CD14 is a bacterial lipopolysaccharide (LPS) binding glycoprotein, expressed as either a GPI-linked membrane protein or a soluble plasma protein. LPS induces an upregulation of GPI-linked CD14 expression, which facilitates TLR4 signaling and macrophage activation in response to bacterial infection. The 61D3 antibody is widely used to identify cells of the monocyte/macrophage lineage. |
Molecular Mass : | ~36 kDa |
AA Sequence : | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD14 CD14 molecule [ Homo sapiens (human) ] |
Official Symbol | CD14 |
Synonyms | CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; |
Gene ID | 929 |
mRNA Refseq | NM_000591 |
Protein Refseq | NP_000582 |
MIM | 158120 |
UniProt ID | P08571 |
◆ Recombinant Proteins | ||
CD14-5308H | Recombinant Human CD14 Protein (Met1-Met344), C-His tagged | +Inquiry |
CD14-123H | Recombinant Human CD14 Protein, His-tagged | +Inquiry |
CD14-6224H | Recombinant Human CD14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cd14-810M | Recombinant Mouse Cd14 Protein, MYC/DDK-tagged | +Inquiry |
CD14-652H | Recombinant Human CD14 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
CD14-2581MCL | Recombinant Mouse CD14 cell lysate | +Inquiry |
CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD14 Products
Required fields are marked with *
My Review for All CD14 Products
Required fields are marked with *
0
Inquiry Basket