Recombinant Human CD14 protein, GST-tagged
| Cat.No. : | CD14-2658H |
| Product Overview : | Recombinant Human CD14 protein(P08571)(20-345aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 20-345aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 62.2 kDa |
| AA Sequence : | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CD14 CD14 molecule [ Homo sapiens ] |
| Official Symbol | CD14 |
| Synonyms | CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; |
| Gene ID | 929 |
| mRNA Refseq | NM_000591 |
| Protein Refseq | NP_000582 |
| MIM | 158120 |
| UniProt ID | P08571 |
| ◆ Recombinant Proteins | ||
| Cd14-2270M | Recombinant Mouse Cd14 protein(Met1-Pro345), His-tagged | +Inquiry |
| Cd14-7M | Recombinant Mouse Cd14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD14-151H | Recombinant Human CD14 Protein, His-tagged | +Inquiry |
| CD14-5309H | Recombinant Human CD14 Protein (Met1-Ala83), C-His tagged | +Inquiry |
| CD14-3887C | Recombinant Chicken CD14 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD14-2581MCL | Recombinant Mouse CD14 cell lysate | +Inquiry |
| CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
| CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
| CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD14 Products
Required fields are marked with *
My Review for All CD14 Products
Required fields are marked with *
