Recombinant Human CD177 protein, T7/His-tagged
Cat.No. : | CD177-63H |
Product Overview : | Recombinant human CD177 (NTN4) gene (22 - 408 aa) fused with T7/His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 22-408 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFELLLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESG PQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSME GCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGT TIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASY THFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSGGGLST KMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGG |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein can be used as coating matrix protein for study human neutrophil-endothelia cell interaction study in vitro.2. As highly purified recombinant antigen, it may be used as culture matrix protein for differentiation of human endothelial cell in vitro. |
Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CD177 CD177 molecule [ Homo sapiens ] |
Official Symbol | CD177 |
Synonyms | CD177; CD177 molecule; CD177 antigen; HNA2A; NB1; polycythemia rubra vera 1; PRV1; NB1 glycoprotein; cell surface receptor; human neutrophil alloantigen 2a; polycythemia rubra vera protein 1; PRV-1; HNA-2a; NB1 GP; |
Gene ID | 57126 |
mRNA Refseq | NM_020406 |
Protein Refseq | NP_065139 |
MIM | 162860 |
UniProt ID | Q8N6Q3 |
Chromosome Location | 19q13.2 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
◆ Recombinant Proteins | ||
CD177-4896H | Recombinant Human CD177 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD177-63H | Recombinant Human CD177 protein, T7/His-tagged | +Inquiry |
CD177-3041H | Recombinant Human CD177 Protein, MYC/DDK-tagged | +Inquiry |
CD177-126H | Recombinant Human CD177 Protein, His-tagged | +Inquiry |
CD177-513H | Recombinant Human CD177 protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD177-778HCL | Recombinant Human CD177 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD177 Products
Required fields are marked with *
My Review for All CD177 Products
Required fields are marked with *
0
Inquiry Basket