Recombinant Human CD177 protein, T7/His-tagged

Cat.No. : CD177-63H
Product Overview : Recombinant human CD177 (NTN4) gene (22 - 408 aa) fused with T7/His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 22-408 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFELLLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESG PQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSME GCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGT TIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASY THFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSGGGLST KMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGG
Purity : >90% by SDS-PAGE
Applications : 1. Protein can be used as coating matrix protein for study human neutrophil-endothelia cell interaction study in vitro.2. As highly purified recombinant antigen, it may be used as culture matrix protein for differentiation of human endothelial cell in vitro.
Storage : Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CD177 CD177 molecule [ Homo sapiens ]
Official Symbol CD177
Synonyms CD177; CD177 molecule; CD177 antigen; HNA2A; NB1; polycythemia rubra vera 1; PRV1; NB1 glycoprotein; cell surface receptor; human neutrophil alloantigen 2a; polycythemia rubra vera protein 1; PRV-1; HNA-2a; NB1 GP;
Gene ID 57126
mRNA Refseq NM_020406
Protein Refseq NP_065139
MIM 162860
UniProt ID Q8N6Q3
Chromosome Location 19q13.2
Pathway Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD177 Products

Required fields are marked with *

My Review for All CD177 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon