Recombinant Human CD1A protein, His-tagged
Cat.No. : | CD1A-24H |
Product Overview : | Recombinant Human CD1A(21-200aa) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-200 a.a. |
Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15% glycerol. |
AA Sequence : | MWNWLKEPLSFHVIWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLWPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQR |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | CD1A CD1a molecule [ Homo sapiens ] |
Official Symbol | CD1A |
Synonyms | CD1A; CD1a molecule; CD1, CD1a antigen , CD1A antigen, a polypeptide; T-cell surface glycoprotein CD1a; hTa1 thymocyte antigen; CD1A antigen, a polypeptide; cluster of differentiation 1 A; T-cell surface antigen T6/Leu-6; cortical thymocyte antigen CD1A; differentiation antigen CD1-alpha-3; epidermal dendritic cell marker CD1a; R4; T6; CD1; FCB6; HTA1; |
Gene ID | 909 |
mRNA Refseq | NM_001763 |
Protein Refseq | NP_001754 |
MIM | 188370 |
UniProt ID | P06126 |
◆ Recombinant Proteins | ||
CD1A-1455H | Recombinant Human CD1A Protein (Leu21-Val300), N-His tagged | +Inquiry |
CD1A-25H | Recombinant Human CD1A protein, GST-tagged | +Inquiry |
CD1A-27866TH | Recombinant Human CD1A protein, GST-tagged | +Inquiry |
CD1A-720R | Recombinant Rhesus monkey CD1A Protein, His-tagged | +Inquiry |
CD1A-151H | Recombinant Human CD1A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1A-174HCL | Recombinant Human CD1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD1A Products
Required fields are marked with *
My Review for All CD1A Products
Required fields are marked with *