Recombinant Human CD1A protein, His-tagged

• Cat.No.: CD1A-24H
• Product Overview: Recombinant Human CD1A(21-200aa) fused with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-200 a.a.
• Form: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15% glycerol.
• AA Sequence: MWNWLKEPLSFHVIWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLWPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQR
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: CD1A CD1a molecule [ Homo sapiens ]
• Official Symbol: CD1A
• Synonyms: CD1A; CD1a molecule; CD1, CD1a antigen , CD1A antigen, a polypeptide; T-cell surface glycoprotein CD1a; hTa1 thymocyte antigen; CD1A antigen, a polypeptide; cluster of differentiation 1 A; T-cell surface antigen T6/Leu-6; cortical thymocyte antigen CD1A; differentiation antigen CD1-alpha-3; epidermal dendritic cell marker CD1a; R4; T6; CD1; FCB6; HTA1
• Gene ID: 909
• mRNA Refseq: NM_001763
• Protein Refseq: NP_001754
• MIM: 188370
• UniProt ID: P06126