Recombinant Human CD1A protein, His-tagged
| Cat.No. : | CD1A-24H |
| Product Overview : | Recombinant Human CD1A(21-200aa) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-200 a.a. |
| Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15% glycerol. |
| AA Sequence : | MWNWLKEPLSFHVIWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLWPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQR |
| Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | CD1A CD1a molecule [ Homo sapiens ] |
| Official Symbol | CD1A |
| Synonyms | CD1A; CD1a molecule; CD1, CD1a antigen , CD1A antigen, a polypeptide; T-cell surface glycoprotein CD1a; hTa1 thymocyte antigen; CD1A antigen, a polypeptide; cluster of differentiation 1 A; T-cell surface antigen T6/Leu-6; cortical thymocyte antigen CD1A; differentiation antigen CD1-alpha-3; epidermal dendritic cell marker CD1a; R4; T6; CD1; FCB6; HTA1; |
| Gene ID | 909 |
| mRNA Refseq | NM_001763 |
| Protein Refseq | NP_001754 |
| MIM | 188370 |
| UniProt ID | P06126 |
| ◆ Recombinant Proteins | ||
| CD1A-367H | Recombinant Human CD1A protein | +Inquiry |
| RFL29630HF | Recombinant Full Length Human T-Cell Surface Glycoprotein Cd1A(Cd1A) Protein, His-Tagged | +Inquiry |
| CD1A-24H | Recombinant Human CD1A protein, His-tagged | +Inquiry |
| CD1A-547R | Recombinant Rhesus Macaque CD1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD1A-26H | Recombinant Human CD1A protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD1A-174HCL | Recombinant Human CD1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD1A Products
Required fields are marked with *
My Review for All CD1A Products
Required fields are marked with *
