Recombinant Human CD1E Protein, C-His-tagged
Cat.No. : | CD1E-167H |
Product Overview : | Recombinant Human CD1E Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The human CD1 family consists of five chromosome 1-localized genes which encode proteins that are involved in mediating the presentation of lipid antigens of microbial or self origin on the surface of immune cells. CD1E, also known as R2 or CD1A, is a 322 amino acid single-pass type I membrane protein that localizes to the lumen of the endoplasmic reticulum, as well as to the Golgi apparatus and contains one Ig-like domain. Expressed in a variety of tissues and on cortical thymocytes, dendritic cells and Langerhans cells, CD1E exists as a heterodimer with β-2-microglobulin and is necessary for the presentation of glycolipid antigens on the cell surface. CD1E is subject to posttranslational mono-ubiquitination and may also be proteolytically cleaved in endosomes to yield a soluble protein. CD1E is present on the surface of some T cell leukemias, suggesting a possible role in tumorigenesis. |
Molecular Mass : | ~30 kDa |
AA Sequence : | EEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIHWGGY |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD1E CD1e molecule [ Homo sapiens (human) ] |
Official Symbol | CD1E |
Synonyms | CD1E; CD1e molecule; CD1e antigen , CD1E antigen, e polypeptide; T-cell surface glycoprotein CD1e, membrane-associated; R2G1; hCD1e; thymocyte antigen CD1E; CD1E antigen, e polypeptide; leukocyte differentiation antigen; differentiation antigen CD1-alpha-3; R2; CD1A; FLJ17609; |
Gene ID | 913 |
mRNA Refseq | NM_001042583 |
Protein Refseq | NP_001036048 |
MIM | 188411 |
UniProt ID | P15812 |
◆ Cell & Tissue Lysates | ||
CD1E-7681HCL | Recombinant Human CD1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD1E Products
Required fields are marked with *
My Review for All CD1E Products
Required fields are marked with *
0
Inquiry Basket