Recombinant Human CD207 Protein, His-tagged
Cat.No. : | CD207-108H |
Product Overview : | Recombinant Human CD207 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Langerin (CD207) is a C-type lectin receptor whose expression is restricted mainly to dendritic cells in the skin including Langerhans cells in the epidermis and langerin+/CD103+ dermal dendritic cells. Langerin is found on the cell surface and within rod-shaped organelles called Birbeck granules, and its expression is required for the formation of Birbeck granules. Langerin recognizes carbohydrate motifs on the surface of pathogens, resulting in endocytosis of the pathogen into Birbeck granules, degradation of the pathogen, and antigen presentation to T cells. |
Molecular Mass : | ~35 kDa |
AA Sequence : | PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD207 CD207 molecule, langerin [ Homo sapiens (human) ] |
Official Symbol | CD207 |
Synonyms | CD207; CD207 molecule, langerin; CD207 antigen, langerin; C-type lectin domain family 4 member K; CLEC4K; Langerin; Langerhans cell specific c-type lectin; C-type lectin domain family 4, member K; |
Gene ID | 50489 |
mRNA Refseq | NM_015717 |
Protein Refseq | NP_056532 |
MIM | 604862 |
UniProt ID | Q9UJ71 |
◆ Recombinant Proteins | ||
CD207-5607H | Active Recombinant Human CD207 Molecule, Langerin, His-tagged | +Inquiry |
CD207-0745H | Recombinant Human CD207 Protein | +Inquiry |
CD207-9932HFL | Recombinant Full Length Human CD207 protein, Flag-tagged | +Inquiry |
CD207-3416H | Recombinant Human CD207 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD207-315H | Recombinant Human CD207 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD207-7680HCL | Recombinant Human CD207 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD207 Products
Required fields are marked with *
My Review for All CD207 Products
Required fields are marked with *