Recombinant Human CD209 Protein, hIgG/His-tagged

Cat.No. : CD209-03H
Product Overview : Recombinant human DC-SIGN/CD209 (60-404 aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 587
Description : This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including leprosy and tuberculosis mycobacteria, the Ebola, hepatitis C, HIV-1 and Dengue viruses, and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CLEC4M (Gene ID: 10332), also known as L-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression on the surface of dendritic cells. Polymorphisms in the neck region are associated with protection from HIV-1 infection, while single nucleotide polymorphisms in the promoter of this gene are associated with differing resistance and susceptibility to and severity of infectious disease, including rs4804803, which is associated with SARS severity.
Form : Liquid
Molecular Mass : 66.5 kDa
AA Sequence : VSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name CD209 CD209 molecule [ Homo sapiens (human) ]
Official Symbol CD209
Synonyms CD209; CD209 molecule; CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1; hDC-SIGN; CD209 antigen; C-type lectin domain family 4 member L; HIV gpl20-binding protein; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin
Gene ID 30835
mRNA Refseq NM_021155
Protein Refseq NP_066978
MIM 604672
UniProt ID Q9NNX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C Products

Required fields are marked with *

My Review for All C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon