Recombinant Human CD274

• Cat.No.: CD274-27112TH
• Product Overview: Recombinant fragment corresponding to aa 141-240 of human CD274 with a proprietary tag; 36.63kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Programmed cell death 1 ligand 1 (PD-L1) also known as cluster of differentiation (CD274) or B7 homolog 1 (B7-H1) is a protein that in humans is encoded by the CD274 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
• Biological activity: This product is useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
• Sequence Similarities: Belongs to the immunoglobulin superfamily. BTN/MOG family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Gene Information

• Gene Name: CD274 CD274 molecule [ Homo sapiens ]
• Official Symbol: CD274
• Synonyms: CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1
• Gene ID: 29126
• mRNA Refseq: NM_014143
• Protein Refseq: NP_054862
• MIM: 605402
• Uniprot ID: Q9NZQ7
• Chromosome Location: 9p24.1
• Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: protein binding; protein tyrosine phosphatase activity; receptor activity