Recombinant Human CD274

Cat.No. : CD274-27112TH
Product Overview : Recombinant fragment corresponding to aa 141-240 of human CD274 with a proprietary tag; 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Programmed cell death 1 ligand 1 (PD-L1) also known as cluster of differentiation (CD274) or B7 homolog 1 (B7-H1) is a protein that in humans is encoded by the CD274 gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
Biological activity : This product is useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
Sequence Similarities : Belongs to the immunoglobulin superfamily. BTN/MOG family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name CD274 CD274 molecule [ Homo sapiens ]
Official Symbol CD274
Synonyms CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1;
Gene ID 29126
mRNA Refseq NM_014143
Protein Refseq NP_054862
MIM 605402
Uniprot ID Q9NZQ7
Chromosome Location 9p24.1
Pathway Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function protein binding; protein tyrosine phosphatase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD274 Products

Required fields are marked with *

My Review for All CD274 Products

Required fields are marked with *

0
cart-icon
0
compare icon