Recombinant Human CD274
| Cat.No. : | CD274-27112TH |
| Product Overview : | Recombinant Human CD274 Protein fragment (141-240aa), was expressed in Wheat Germ with proprietary tag (molecular weight: 36.63kDa inclusive of tag). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 141-240 aa |
| Description : | Programmed cell death 1 ligand 1 (PD-L1) also known as cluster of differentiation (CD274) or B7 homolog 1 (B7-H1) is a protein that in humans is encoded by the CD274 gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. |
| Biological activity : | This product is useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced. |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH |
| Sequence Similarities : | Belongs to the immunoglobulin superfamily. BTN/MOG family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Gene Name | CD274 CD274 molecule [ Homo sapiens ] |
| Official Symbol | CD274 |
| Synonyms | CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; |
| Gene ID | 29126 |
| mRNA Refseq | NM_014143 |
| Protein Refseq | NP_054862 |
| MIM | 605402 |
| Uniprot ID | Q9NZQ7 |
| Chromosome Location | 9p24.1 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
| Function | protein binding; protein tyrosine phosphatase activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| Cd274-561RAF555 | Recombinant Rat Cd274 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CD274-710H | Recombinant Human CD274 Protein, IgG1 Fc-tagged | +Inquiry |
| CD274-020HAF488 | Active Recombinant Human CD274 Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| CD274-002HAF647 | Active Recombinant Human CD274 Protein, MIgG2a mFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD274-010HA | Recombinant Human CD274 protein, mutant HIgG1 Fc-tagged, APC labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
| CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
| CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
| CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
