Recombinant Human CD274
Cat.No. : | CD274-27112TH |
Product Overview : | Recombinant fragment corresponding to aa 141-240 of human CD274 with a proprietary tag; 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Programmed cell death 1 ligand 1 (PD-L1) also known as cluster of differentiation (CD274) or B7 homolog 1 (B7-H1) is a protein that in humans is encoded by the CD274 gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. |
Biological activity : | This product is useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced. |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. BTN/MOG family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | CD274 CD274 molecule [ Homo sapiens ] |
Official Symbol | CD274 |
Synonyms | CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; |
Gene ID | 29126 |
mRNA Refseq | NM_014143 |
Protein Refseq | NP_054862 |
MIM | 605402 |
Uniprot ID | Q9NZQ7 |
Chromosome Location | 9p24.1 |
Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | protein binding; protein tyrosine phosphatase activity; receptor activity; |
◆ Recombinant Proteins | ||
CD274-010HF | Active Recombinant Human CD274 Protein, hFc-tagged, FITC conjugated | +Inquiry |
CD274-1411H | Recombinant Human CD274 protein, His&Myc-tagged | +Inquiry |
CD274-952H | Recombinant Human CD274 protein, hFc-tagged | +Inquiry |
Cd274-7693R | Recombinant Rat Cd274 protein, His & GST-tagged | +Inquiry |
Cd274-593M | Recombinant Mouse Cd274, Fc-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *