| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
19-240 aa |
| Description : |
This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. |
| AA Sequence : |
MPGFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHHHHHH |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
Research in immunotherapy |
| Quality Control Test : |
Verified by disulfide mapping and Mass Spectrometry analysis. |
| Notes : |
For research use only |
| Storage : |
Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade. |
| Concentration : |
0.5 mg/mL |
| Storage Buffer : |
Sterile filtered through a 0.2 micron filter in 20 mM Tris buffer at pH8. |