Recombinant Human CD274 Protein (F19-H240), C-6×His tagged
Cat.No. : | CD274-76H |
Product Overview : | Recombinant human PD-L1/CD274, extracellular domain is produced in E. coli. The final protein sequence contains F19-H240 of human PD-L1 fused to a polyhistidine tag on the carboxyl terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | F19-H240 |
Description : | This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. |
AA Sequence : | MPGFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHHHHHH |
Purity : | > 95% by SDS-PAGE |
Applications : | Research in immunotherapy |
Quality Control Test : | Verified by disulfide mapping and Mass Spectrometry analysis. |
Notes : | For research use only |
Storage : | Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | Sterile filtered through a 0.2 micron filter in 20 mM Tris buffer at pH8. |
Gene Name | CD274 CD274 molecule [ Homo sapiens (human) ] |
Official Symbol | CD274 |
Synonyms | CD274; CD274 molecule; CD274 antigen, PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296 |
Gene ID | 29126 |
mRNA Refseq | NM_014143 |
Protein Refseq | NP_054862 |
MIM | 605402 |
UniProt ID | Q9NZQ7 |
◆ Recombinant Proteins | ||
CD274-1058CA | Recombinant Canine CD274 protein, Fc-tagged, APC labeled | +Inquiry |
CD274-1411H | Recombinant Human CD274 protein, His&Myc-tagged | +Inquiry |
Cd274-821MAF647 | Recombinant Mouse Cd274 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD274-0763H | Recombinant Human CD274 Protein, His-Flag-StrepII-Tagged | +Inquiry |
CD274-6775H | Recombinant Human CD274 Molecule, His-tagged | +Inquiry |
◆ Native Proteins | ||
CD274-77M | Active Recombinant Mouse CD274 Protein, Fctagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
0
Inquiry Basket