Recombinant Human CD274 protein, His-tagged
| Cat.No. : | CD274-3309H |
| Product Overview : | Recombinant Human CD274 protein(181-290 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 181-290 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CD274 CD274 molecule [ Homo sapiens ] |
| Official Symbol | CD274 |
| Synonyms | CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296; |
| Gene ID | 29126 |
| mRNA Refseq | NM_014143 |
| Protein Refseq | NP_054862 |
| MIM | 605402 |
| UniProt ID | Q9NZQ7 |
| ◆ Native Proteins | ||
| CD274-77M | Active Recombinant Mouse CD274 Protein, Fctagged | +Inquiry |
| Cd274-51M | Active Recombinant Mouse CD274 Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
| CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
| CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
| CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
