Recombinant Human CD274 Protein, His-tagged
Cat.No. : | CD274-054H |
Product Overview : | Recombinant Human CD274 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Programmed cell death 1 ligand 1 (PD-L1, B7-H1, CD274) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses. The PD-L1 ligand binds the PD-1 transmembrane receptor and inhibits T cell activation. PD-L1 was discovered following a search for novel B7 protein homologs and was later shown to be expressed by antigen presenting cells, activated T cells, and tissues including placenta, heart, and lung. Similar in structure to related B7 family members, PD-L1 protein contains extracellular IgV and IgC domains and a short, cytoplasmic region. Research studies demonstrate that PD-L1 is expressed in several tumor types, including melanoma, ovary, colon, lung, breast, and renal cell carcinomas. Expression of PD-L1 in cancer is associated with tumor-infiltrating lymphocytes, which mediate PD-L1 expression through the release of interferon gamma. Additional research links PD-L1 expression to cancers associated with viral infections. |
Molecular Mass : | ~30 kDa |
AA Sequence : | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD274 CD274 molecule [ Homo sapiens (human) ] |
Official Symbol | CD274 |
Synonyms | CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296; |
Gene ID | 29126 |
mRNA Refseq | NM_014143 |
Protein Refseq | NP_054862 |
MIM | 605402 |
UniProt ID | Q9NZQ7 |
◆ Recombinant Proteins | ||
CD274-706C | Recombinant Cynomolgus monkey CD274 Protein | +Inquiry |
CD274-74H | Recombinant Human CD274 Protein, Biotin Labeled | +Inquiry |
CD274-2330H | Active Recombinant Human CD274 protein(Met1-Thr239), hFc-tagged | +Inquiry |
CD274-199CAF647 | Recombinant Monkey CD274 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD274-256H | Recombinant Human CD274, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
CD274-77M | Active Recombinant Mouse CD274 Protein, Fctagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
0
Inquiry Basket