Recombinant Human CD274 Protein, His-tagged

Cat.No. : CD274-054H
Product Overview : Recombinant Human CD274 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Programmed cell death 1 ligand 1 (PD-L1, B7-H1, CD274) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses. The PD-L1 ligand binds the PD-1 transmembrane receptor and inhibits T cell activation. PD-L1 was discovered following a search for novel B7 protein homologs and was later shown to be expressed by antigen presenting cells, activated T cells, and tissues including placenta, heart, and lung. Similar in structure to related B7 family members, PD-L1 protein contains extracellular IgV and IgC domains and a short, cytoplasmic region. Research studies demonstrate that PD-L1 is expressed in several tumor types, including melanoma, ovary, colon, lung, breast, and renal cell carcinomas. Expression of PD-L1 in cancer is associated with tumor-infiltrating lymphocytes, which mediate PD-L1 expression through the release of interferon gamma. Additional research links PD-L1 expression to cancers associated with viral infections.
Molecular Mass : ~30 kDa
AA Sequence : FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD274 CD274 molecule [ Homo sapiens (human) ]
Official Symbol CD274
Synonyms CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296;
Gene ID 29126
mRNA Refseq NM_014143
Protein Refseq NP_054862
MIM 605402
UniProt ID Q9NZQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD274 Products

Required fields are marked with *

My Review for All CD274 Products

Required fields are marked with *

0
cart-icon